- Recombinant Human Probable low affinity copper uptake protein 2 (SLC31A2)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1103670
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 15,681 Da
- E Coli or Yeast
- 1-143
- solute carrier family 31 (copper transporter), member 2
- hCTR2, COPT2, CTR2
- Probable low affinity copper uptake protein 2 (SLC31A2)
Sequence
MAMHFIFSDTAVLLFDFWSVHSPAGMALSVLVLLLLAVLYEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDSAGSDSFPVGRTHHRWYLCHFGQSLIHVIQVVIGYFIMLAVMSYNTWIFLGVVLGSAVGYYLAYPLLSTA